PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma291g00020.1
Common NameZOSMA_291G00020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family TALE
Protein Properties Length: 317aa    MW: 35665.9 Da    PI: 5.8714
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma291g00020.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.91.5e-072662992154
                       HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       k +yp+++++++L +++gL  +q+ +WF N+R +
  Zosma291g00020.1 266 KWPYPTEDDKARLVQETGLHLKQINNWFINQRKR 299
                       569*****************************87 PP

2ELK29.81.4e-10220241122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       ELKh+L+++Y+ +++++++E++
  Zosma291g00020.1 220 ELKHELKQGYKDKIVDIREEIL 241
                       9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.6E-195296IPR005540KNOX1
PfamPF037901.1E-175595IPR005540KNOX1
SMARTSM012563.8E-29110165IPR005541KNOX2
PfamPF037911.5E-20114164IPR005541KNOX2
PROSITE profilePS512139.969220240IPR005539ELK domain
SMARTSM011885.1E-4220241IPR005539ELK domain
PfamPF037899.9E-6220241IPR005539ELK domain
PROSITE profilePS5007111.451240303IPR001356Homeobox domain
SuperFamilySSF466891.07E-15242305IPR009057Homeodomain-like
SMARTSM003891.5E-10242307IPR001356Homeobox domain
CDDcd000861.98E-11243304No hitNo description
Gene3DG3DSA:1.10.10.604.9E-24247304IPR009057Homeodomain-like
PfamPF059203.0E-17260299IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MQNPHPHAYG DGSFLHLQTT EDEVVPVSGD SMIGSAGGNP PHDGGEITWQ NARSKAEILA  60
HPLYEQLLSA HVACLRIATP VDQLPRIDAQ LEQSQNVVAK YSVLGGQQMM AGCAGDDKEL  120
DQFMTHYVLL LCSFKEQLQQ HVRVHAMEAV MACWELEQSL QNLTGVSPGE GTGATMSDEE  180
EEQEDSETNL YDGGLEGHDS MGFGLPTESE RSLMERVRQE LKHELKQGYK DKIVDIREEI  240
LRKRRAGKLP GDTTSRLKEW WQSHSKWPYP TEDDKARLVQ ETGLHLKQIN NWFINQRKRN  300
WHSNPSSSTG KSKRKR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A2e-12243307872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1296315RKRNWHSNPSSSTGKSKRKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009408038.11e-173PREDICTED: homeobox protein knotted-1-like 13
SwissprotP480001e-167KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A0K9PEH80.0A0A0K9PEH8_Z
STRINGGSMUA_Achr7P05170_0011e-173(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-163KNOTTED1-like homeobox gene 3